logo
Gửi tin nhắn
Shaanxi Hongbaiyi Biotech Co., Ltd.
Shaanxi Hongbaiyi Biotech Co., Ltd.
các sản phẩm
Nhà /

các sản phẩm

Buy Tirzepatide, LL-37 20mg (CAP-18) 99% Purity Lyophilized Powder Vials

Thông tin chi tiết sản phẩm

Place of Origin: China

Hàng hiệu: Hongbaiyi

Chứng nhận: COA, HPLC MR

Model Number: HBY-Ipamorelin

Tài liệu: Sổ tay sản phẩm PDF

Điều khoản thanh toán & vận chuyển

Minimum Order Quantity: 5 kits

Giá bán: negotiable

Packaging Details: 20mg/vial, 10vials/box

Delivery Time: 3-5 work days after your payment

Payment Terms: MoneyGram, Western Union, T/T

Supply Ability: 1000 boxes/Month

Nhận giá tốt nhất
Liên hệ ngay
Thông số kỹ thuật
Làm nổi bật:
Product Name:
Buy LL-37 20mg Online
Cas No.:
154947-66-7
Formula:
C205H340N60O53
M.Wt:
4493.32
Appearance:
Powder
Purity:
99%
Sequence:
[LL-37, 37 aa]
Product Name:
Buy LL-37 20mg Online
Cas No.:
154947-66-7
Formula:
C205H340N60O53
M.Wt:
4493.32
Appearance:
Powder
Purity:
99%
Sequence:
[LL-37, 37 aa]
Mô tả
Buy Tirzepatide, LL-37 20mg (CAP-18) 99% Purity Lyophilized Powder Vials

Buy Tirzepatide, LL-37 20mg (CAP-18)  99% Purity Lyophilized Powder Vials 0

              Buy Tirzepatide, LL-37 20mg (CAP-18) 99% Purity Lyophilized Powder Vials.

 

Basic Information Form of Buy LL-nline37 20mg Online

Product Name

Buy LL-37 20mg Online

Purity

99%

MF

C38H49N9O5

MW

711.86

Cas No. 170851-70-4

Shelf Life

2 years

Form

Powder

Storage Appearance

Stored in a cool, dry place

 

Introduction to LL-37

LL-37 is a human antimicrobial peptide (AMP) and the sole member of the human cathelicidin family. It is a key component of the innate immune system, serving as a first line of defense against a wide range of pathogens. The name "LL-37" comes from its amino acid sequence, which begins with two leucine (L) residues and contains 37 amino acids in total.

 

LL-37 is not produced directly. It is derived from a precursor protein called hCAP-18, which is stored in various cells, including neutrophils, macrophages, and epithelial cells of the skin, respiratory tract, and gut. When the body needs to fight an infection, hCAP-18 is cleaved by enzymes to release the active LL-37 peptide. This process allows for a rapid, on-demand response to microbial threats.

 

Usage and Mechanisms of Action

LL-37's primary function is to combat infections. It has a broad-spectrum antimicrobial activity, meaning it is effective against Gram-positive and Gram-negative bacteria, as well as fungi and some viruses. Its primary mechanism of action is membrane disruption. Due to its positive charge, LL-37 is attracted to the negatively charged membranes of bacteria. It then inserts itself into the membrane, forming pores that lead to cell lysis and death. This mechanism is different from that of conventional antibiotics, which makes LL-37 a potential alternative for treating infections caused by antibiotic-resistant strains, such as MRSA.

 

Beyond its direct antimicrobial effects, LL-37 also has significant immunomodulatory functions. It can:

  • Attract immune cells: LL-37 acts as a chemoattractant, drawing neutrophils, monocytes, and T cells to the site of infection.

  • Modulate inflammation: LL-37 can have both pro-inflammatory and anti-inflammatory effects depending on the context. It can stimulate the production of specific cytokines to initiate an inflammatory response, but it can also help to resolve inflammation by neutralizing bacterial toxins and downregulating inflammatory pathways.

  • Promote wound healing: LL-37 supports tissue repair by stimulating the migration of epithelial cells and fibroblasts, promoting the formation of new blood vessels (angiogenesis), and enhancing collagen deposition.

 

Product Photo of LL-37

Buy Tirzepatide, LL-37 20mg (CAP-18)  99% Purity Lyophilized Powder Vials 1

 

Benefits and Potential Applications

 

The unique properties of LL-37 have led to its investigation for a wide range of therapeutic applications. Some of the potential benefits and uses include:

  • Treatment of chronic wounds and skin infections: Clinical studies have shown that the topical application of LL-37 can be safe and effective in enhancing the healing of chronic wounds, such as venous leg ulcers and diabetic foot ulcers. Its combined antimicrobial and wound-healing properties make it a promising candidate for treating polymicrobial infected wounds.

  • Alternative to antibiotics: As antibiotic resistance becomes a growing global health concern, LL-37 offers a potential new class of antimicrobial agents. Its ability to disrupt bacterial membranes and kill multi-drug resistant strains is a significant advantage.

  • Anti-cancer effects: Research has shown that LL-37 has complex and sometimes contradictory roles in cancer. In some cases, it can inhibit the growth of various cancer cells (e.g., colon, gastric, and oral squamous cell carcinoma), while in others, it may promote tumor progression. Its anti-cancer mechanism involves inducing apoptosis (programmed cell death) and influencing cell signaling pathways.

  • Immunomodulatory therapy: LL-37's ability to regulate immune responses makes it a subject of interest for treating inflammatory and autoimmune diseases. However, its complex role is highlighted in conditions like psoriasis and rosacea, where excessive levels of LL-37 may contribute to the disease's pathogenesis.

 

 

Package and Shipping of Ipamorelin For Sale


Package: 20mg/vial, 10vials/box

Shipping: With 3-5 days after your payment

Buy Tirzepatide, LL-37 20mg (CAP-18)  99% Purity Lyophilized Powder Vials 2

 

FAQ of LL-37

 

Q1: Do you Accept Sample orders?

A: Yes. The smallest order we accept is one box.

 

Q2: Do you accept a VISA business credit card?

A: Yes. The VISA business credit card is for our payment.

 

Q3: Is there any discount?
A: Yes, if you want to purchase a larger quantity, we can offer a better price for you.

 

Q4: How long does it take for me to receive my order?

A: About 3-5 days upon receipt of payment.

 

Q5: What kind of transportation do you have?

A: We have many ways of transportations, eg: Air, Sea, Special Lines, TNT, FEDEX, EMS, etc.

 

 

 

Gửi yêu cầu của bạn
Vui lòng gửi yêu cầu của bạn và chúng tôi sẽ trả lời bạn càng sớm càng tốt.
Gửi